Sign In | Join Free | My carsrow.com
carsrow.com
Products
Search by Category
Home > Construction & Real Estate > Flooring & Accessories > Flooring Accessories >

Foam Underlay Roll Noise Reduction

foam underlay roll noise reduction

All foam underlay roll noise reduction wholesalers & foam underlay roll noise reduction manufacturers come from members. We doesn't provide foam underlay roll noise reduction products or service, please contact them directly and verify their companies info carefully.

Total 128 products from foam underlay roll noise reduction Manufactures & Suppliers
 Laminate Foam Underlay Roll Noise Reduction 20KG/M3 EPE 2mm Manufactures

Brand Name:new top star

Model Number:EPE20-4

Place of Origin:china

...Underlay Roll Noise Reduction For Laminated Wooden Flooring 2MM EPE foam with PE FILM Overlapped EPE Underlayment for laminated wooden flooring Product descripition Our 2mm poly cell foam, moister barrier Supreme Underlay is suitable for use with Laminate and Engineered wood floors. This lightweight, dust free underlay...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

 3mm Thick Eva Foam Underlayment 200sqft/Roll Vinyl Tile Noise Reduction Underlay Manufactures

Brand Name:No brand

Model Number:EVA 30-G

Place of Origin:China

... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and even laminate floors. Using EVA underlay as a

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

 Reliable 50mm 100mm Rockwool Roll Noise Reduction Flame Retardant Manufactures

Brand Name:Pholus

Place of Origin:Hebei,China

Rockwool Insulation Roll 1.2m Width Less Than 0.1mg/L Formaldehyde Emission For Stone Wool *, *::before, *::after {box-sizing: border-box; } * {margin: 0; } html, body {height: 100%; } body {line-height: 1.5; -webkit-font-smoothing: antialiased; } img, ...

Hebei Fuluosi Building Materials Group Co., Ltd
Active Member

Hebei

 Non Slip 10mm Thick PU Foam Luxury Carpet Underlay Roll Green 7mm 4mm Manufactures

Brand Name:LINKWIN

Model Number:ZL-CP-7

Place of Origin:China

...foam underlay floor mat carpet roll for inner installation Advantages: 1. We are factory 2. OEM&ODM 3. Environmently friendly 4. OEM&ODM service 5. Luxury underfoot comfort 6. Impact resistant 7. Fire-retardant 8. Antibacterial , for healthful environment 9. Unaffected by moisture 10. Noise reduction...

ZhenJiang Linkwin International Trading Co., Ltd.
Active Member

Jiangsu

 Soundproof IXPE Foam Underlayment Attached Pad For Hard Surface Floors Manufactures

Brand Name:EkkoFlex

Place of Origin:Made In China

...Foam Underlayment Attached Pad For Hard Surface Floors The soundproof IXPE foam underlayment with an attached pad is a game-changer for hard surface floors. It significantly reduces impact and airborne noise, making it ideal for multi-story buildings, apartments, and offices. The foam's dense structure absorbs sound vibrations, creating a quieter living and working environment. Besides noise reduction...

Shenzhen Eco Polyfoam Products Co., Ltd.
Verified Supplier

Guangdong

 Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam Manufactures

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

 Foam Underlay Molded Rubber Products for Laminate Flooring Thermal Insulation Manufactures

Brand Name:Skypro

Model Number:FU1003

Place of Origin:China

...Foam Underlayment for Laminate Flooring Thermal Insulation Damp-proof EPE Foam Underlayment Specification: EPE Flooring Underlay Specification Density 25kg/m3 (customize available) Roll size 200sq.ft.(1.1m x 16.9m); 100sq.ft.(1.1m x 16.9m); Customizable Thickness 2mm 3mm 4mm 5mm, be made as your requirement Foam...

Nanjing Skypro Rubber&Plastic Co.,ltd
Verified Supplier

Jiangsu

 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Manufactures

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

 Professional Foam Sponge Low Noise Knife Crushing Machine Blade Shredder Crusher Manufactures

Brand Name:Xinmei

Model Number:TDP-S-4

Place of Origin:Qingdao, China

...Foam Sponge Low Noise Knife Crushing Machine Blade Shredder Crusher Product Description: This machine is mainly used for crushing sponge, cloth sponge, PEA, EVA, plastic and rubber, and can be used in conjunction with foam recycling equipment. It is equipped with a noise reduction and damping device. The advantages include high crushing efficiency, low noise...

Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier

Shandong

 Shock Absorption Rubber Mat Sound Insulation Rubber Underlayment Roll For Flooring Manufactures

Brand Name:JOYWAY

Model Number:Tile-06

Place of Origin:SHANDONG, CHINA

... beautiful , and durable , can enhance the dust removing effect. Cleaning is simple and convenient, a salt water, brush can care. Rubber EPDM roll offers excellent underfoot comfort, absorbs walking noise and the shock of training impact. Being made of

JOYWAY INDUSTRIAL COMPANY LIMITED
Verified Supplier

Shandong

 Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm Manufactures

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

 Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones Manufactures

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

 Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones Manufactures

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

 Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs Manufactures

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor Manufactures

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

 Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip Manufactures

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Site Member

Sichuan

 Rubber Matting Roll Garage Warehouse Industrial Work Non Slip Noise Reduction Manufactures

Brand Name:Flooring Source

Model Number:FS-R100

Place of Origin:China

...Roll Garage Warehouse Industrial Work Non Slip Noise Reduction Non-slip rubber matting roll designed for garage, warehouse and industrial work use is a heavy-duty flooring solution tailored to withstand high-traffic environments while providing traction, durability and comfort. ◆ The matting roll...

Aomi International (Beijing) Co., Ltd
Verified Supplier

Beijing

 FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design Manufactures

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

FUTURE TECH LIMITED
Verified Supplier

 Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction Manufactures

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request