Sign In | Join Free | My carsrow.com
carsrow.com
Products
Search by Category

foam noise reduction

All foam noise reduction wholesalers & foam noise reduction manufacturers come from members. We doesn't provide foam noise reduction products or service, please contact them directly and verify their companies info carefully.

Total 8560 products from foam noise reduction Manufactures & Suppliers
 Energy Saving Construction Heat Insulation Foam Noise Reduction Anti Condensation Manufactures

Brand Name:CYG

Model Number:NON

Place of Origin:Guangdong, China (Mainland)

reflecting fireproof sound and heat insulation sheet materials ixpe foam for roof Closed Cell Cross Linked Rolls & Laminated Sheets Rolls, sheets and multi-layer laminated blocks manufactured from cross linked closed cell PE foam exhibit all the attributes...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

 Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam Manufactures

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

 Durable Silicone Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications Manufactures

Model Number:Z-Foam800-10SEC

Brand Name:Ziitek

Place of Origin:China

...formed by the foaming of polysiloxane, retaining the excellent properties of silicone polymers, such as resistance to high and low temperatures, ultraviolet light, ozone, weatherability, insulation, and ...

Dongguan Ziitek Electronical Material and Technology Co., Ltd
Verified Supplier

Guangdong

 Safety Reusable Silicone Earplugs 31.5*12.5mm with 32dB SNR Noise Reduction and Washable Design Manufactures

Brand Name:Futuretech

Model Number:FTFE-04

Place of Origin:Shenzhen

... Silicone Foam Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protection in various environments. Key Features Perfect Noise Reduction Provides maximum noise reduction (NRR 25dB...

FUTURE TECH LIMITED
Verified Supplier

 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment Manufactures

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

 EVA Floor Soundproof Film | Noise Reduction Flooring Underlayment Supplier Manufactures

Model Number:SR

Brand Name:SR

Place of Origin:CHINA

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, sound insulation, and durability. This product is

Changzhou Sponge & Rubber Products Co., Ltd
Verified Supplier

Jiangsu

 Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor Manufactures

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

 Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm Manufactures

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

 Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones Manufactures

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

 Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones Manufactures

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

 Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs Manufactures

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor Manufactures

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

 NOISE REDUCTION HEADPHONE #ANC-J3 Manufactures

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Shenzhen Bowei Electronics Co.,Ltd.
Active Member

Guangdong

 Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip Manufactures

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Active Member

Sichuan

 Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction Manufactures

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

 Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone Manufactures

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Shengpai Electronics Co,ltd
Active Member

Guangdong

 Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption Manufactures

Brand Name:huashida

Place of Origin:Qingdao, China

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-...

Qingdao Huashida Machinery Co., Ltd.
Verified Supplier

Shandong

 Acoustic Foam Self Adhesive Rolls Fire Resistant PET For Noise Reduction Manufactures

Place of Origin:China Guangdogn

Brand Name:HY

Brand name HY Type Acoustic Foam Usage Living room, read room, media room,ktv, cinema,bar, library Size 30*30cm, 60*60cm Density 2400g/sqm,3000g/sqm Color 40+ color or customized ODM Accept Pattern Customizable supply Ability 8000 SQM day Feature Flame ...

HY New Material Technology Co., Ltd
Verified Supplier

Guangdong

 Wearproof Noise Reduction CR Sealed Foam For Mop Making Manufactures

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and plastic products are new environment-friendly ...

Kunshan Honteck Electronic Material Co., Ltd
Active Member

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request